Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PGC1α Rabbit pAb (A12348)

Reviews (2) Publications (63) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PGC1α Rabbit pAb (A12348)

Western blot analysis of various lysates, using PGC1α Rabbit pAb (A12348) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - PGC1α Rabbit pAb (A12348)

Immunohistochemistry analysis of PGC1α in paraffin-embedded human liver using PGC1α Rabbit pAb (A12348) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of HeLa cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of HepG2 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of NIH/3T3 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of PC-12 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of RD cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of U2OS cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for PGC1α Rabbit pAb(A12348)
Review
ABclonal: review for PGC1α Rabbit pAb(A12348)

You may also interested in:

Overview

Product name PGC1α Rabbit pAb
Catalog No. A12348
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 610-798 of human PGC1α (NP_037393.1).
Sequence HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Gene ID 10891
Swiss prot Q9UBK2
Synonyms LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1alpha; PGC-1(alpha); PGC1α
Calculated MW 91kDa
Observed MW 102kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, mouse skeletal muscle, mouse kidney, rat kidney
Cellular location Cytoplasm, Nucleus, PML body
Customer validation

IF (mouse cellsRattus norvegicus, Gallus gallus, Rattus norvegicus)

WB (Rabbit cerebral microvascular endothelial cellsRattus norvegicus, Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus, Hordeum vulgare, Capra hircus, Carassius gibelio, Gibel carp, Sus scrofa)

IHC (Homo sapiens, Rattus norvegicus, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PGC1α Rabbit pAb images

ABclonal:Western blot - PGC1α Rabbit pAb (A12348)}

Western blot - PGC1α Rabbit pAb (A12348)

Western blot analysis of various lysates, using PGC1α Rabbit pAb (A12348) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - PGC1α Rabbit pAb (A12348)}

Immunohistochemistry - PGC1α Rabbit pAb (A12348)

Immunohistochemistry analysis of PGC1α in paraffin-embedded human liver using PGC1α Rabbit pAb (A12348) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)}

Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of HeLa cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)}

Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of HepG2 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)}

Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of NIH/3T3 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)}

Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of PC-12 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)}

Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of RD cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PGC1α Rabbit pAb (A12348)}

Immunofluorescence - PGC1α Rabbit pAb (A12348)

Immunofluorescence analysis of U2OS cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A12348

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A12348 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPARGC1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPARGC1A. (Distance between topics and target gene indicate popularity.) PPARGC1A

* Data provided by citexs.com, for reference only.

Publishing research using A12348? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order