Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PER2 Rabbit pAb (A13168)

Publications (10) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PER2 Rabbit pAb (A13168)

Western blot analysis of lysates from 293T cells, using PER2 Rabbit pAb (A13168) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - PER2 Rabbit pAb (A13168)

Western blot analysis of lysates from Mouse liver, using PER2 Rabbit pAb (A13168) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PER2 Rabbit pAb (A13168)

Immunohistochemistry analysis of PER2 in paraffin-embedded rat spleen using PER2 Rabbit pAb (A13168) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PER2 Rabbit pAb (A13168)

Immunohistochemistry analysis of PER2 in paraffin-embedded human thyroid cancer using PER2 Rabbit pAb (A13168) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PER2 Rabbit pAb (A13168)

Immunohistochemistry analysis of PER2 in paraffin-embedded mouse testis using PER2 Rabbit pAb (A13168) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Chromatin Immunoprecipitation - PER2 Rabbit pAb (A13168)

Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (A13168) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name PER2 Rabbit pAb
Catalog No. A13168
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 390-565 of human PER2 (NP_073728.1).
Sequence GQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGV
Gene ID 8864
Swiss prot O15055
Synonyms FASPS; FASPS1; PER2
Calculated MW 137kDa
Observed MW 136kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, Mouse liver
Cellular location Cytoplasm, Nucleus, nucleolus, perinuclear region
Customer validation

WB (Mus musculus, Rattus norvegicus)

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PER2 Rabbit pAb images

ABclonal:Western blot - PER2 Rabbit pAb (A13168)}

Western blot - PER2 Rabbit pAb (A13168)

Western blot analysis of lysates from 293T cells, using PER2 Rabbit pAb (A13168) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - PER2 Rabbit pAb (A13168)}

Western blot - PER2 Rabbit pAb (A13168)

Western blot analysis of lysates from Mouse liver, using PER2 Rabbit pAb (A13168) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - PER2 Rabbit pAb (A13168)}

Immunohistochemistry - PER2 Rabbit pAb (A13168)

Immunohistochemistry analysis of PER2 in paraffin-embedded rat spleen using PER2 Rabbit pAb (A13168) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PER2 Rabbit pAb (A13168)}

Immunohistochemistry - PER2 Rabbit pAb (A13168)

Immunohistochemistry analysis of PER2 in paraffin-embedded human thyroid cancer using PER2 Rabbit pAb (A13168) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PER2 Rabbit pAb (A13168)}

Immunohistochemistry - PER2 Rabbit pAb (A13168)

Immunohistochemistry analysis of PER2 in paraffin-embedded mouse testis using PER2 Rabbit pAb (A13168) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Chromatin Immunoprecipitation - PER2 Rabbit pAb (A13168)}

Chromatin Immunoprecipitation - PER2 Rabbit pAb (A13168)

Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (A13168) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A13168 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PER2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PER2. (Distance between topics and target gene indicate popularity.) PER2

* Data provided by citexs.com, for reference only.

Publishing research using A13168? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order