Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PEDF/SERPINF1 Rabbit mAb (A3475)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PEDF/SERPINF1 Rabbit mAb (A3475)

Western blot analysis of extracts of Mouse liver, using PEDF/SERPINF1 Rabbit mAb (A3475) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - PEDF/SERPINF1 Rabbit mAb (A3475)

Western blot analysis of extracts of various cell lines, using PEDF/SERPINF1 Rabbit mAb (A3475) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name PEDF/SERPINF1 Rabbit mAb
Catalog No. A3475
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0784

Background

This gene encodes a member of the serpin family that does not display the serine protease inhibitory activity shown by many of the other serpin proteins. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEDF/SERPINF1 (P36955).
Sequence MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRT
Gene ID 5176
Swiss prot P36955
Synonyms OI6; OI12; PEDF; EPC-1; PIG35; PEDF/SERPINF1
Calculated MW 46kDa
Observed MW 46kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat liver, Human plasma, Mouse liver
Cellular location Melanosome, Secreted
Customer validation

WB (Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PEDF/SERPINF1 Rabbit mAb images

ABclonal:Western blot - PEDF/SERPINF1 Rabbit mAb (A3475)}

Western blot - PEDF/SERPINF1 Rabbit mAb (A3475)

Western blot analysis of extracts of Mouse liver, using PEDF/SERPINF1 Rabbit mAb (A3475) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - PEDF/SERPINF1 Rabbit mAb (A3475)}

Western blot - PEDF/SERPINF1 Rabbit mAb (A3475)

Western blot analysis of extracts of various cell lines, using PEDF/SERPINF1 Rabbit mAb (A3475) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A3475 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SERPINF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SERPINF1. (Distance between topics and target gene indicate popularity.) SERPINF1

* Data provided by citexs.com, for reference only.

Publishing research using A3475? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order