Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PD-L1/CD274 Rabbit pAb (A1645)

Reviews (2) Publications (25) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PD-L1/CD274 Rabbit pAb (A1645)

Western blot analysis of lysates from Mouse heart, using PD-L1/CD274 Rabbit pAb (A1645) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - PD-L1/CD274 Rabbit pAb (A1645)

Immunofluorescence analysis of paraffin-embedded human placenta using PD-L1/CD274 Rabbit pAb (A1645) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for PD-L1/CD274 Rabbit pAb(A1645)
Review
ABclonal: review for PD-L1/CD274 Rabbit pAb(A1645)

You may also interested in:

Overview

Product name PD-L1/CD274 Rabbit pAb
Catalog No. A1645
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 190-290 of human PD-L1/CD274 (NP_054862.1).
Sequence LFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
Gene ID 29126
Swiss prot Q9NZQ7
Synonyms B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; PD-L1/CD274
Calculated MW 33kDa
Observed MW 40-50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse heart
Cellular location Cell membrane, Endomembrane system, Single-pass type I membrane protein
Customer validation

IHC (Human gastric cancer tissue,Human gastric mucosa, Human liver cancerHomo sapiens, Mus musculus, Homo sapiens)

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

IF (Homo sapiens, Mus musculus)

Drug antibody (Homo sapiens)

WB FC (Homo sapiens)

PD-1/PD-L1 inhibitor resistance experiments (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PD-L1/CD274 Rabbit pAb images

ABclonal:Western blot - PD-L1/CD274 Rabbit pAb (A1645)}

Western blot - PD-L1/CD274 Rabbit pAb (A1645)

Western blot analysis of lysates from Mouse heart, using PD-L1/CD274 Rabbit pAb (A1645) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - PD-L1/CD274 Rabbit pAb (A1645)}

Immunofluorescence - PD-L1/CD274 Rabbit pAb (A1645)

Immunofluorescence analysis of paraffin-embedded human placenta using PD-L1/CD274 Rabbit pAb (A1645) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1645

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1645 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD274. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD274. (Distance between topics and target gene indicate popularity.) CD274

* Data provided by citexs.com, for reference only.

Publishing research using A1645? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order