Reviews (2) Publications (25) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | PD-L1/CD274 Rabbit pAb |
---|---|
Catalog No. | A1645 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 190-290 of human PD-L1/CD274 (NP_054862.1). |
---|---|
Sequence | LFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET |
Gene ID | 29126 |
Swiss prot | Q9NZQ7 |
Synonyms | B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; PD-L1/CD274 |
Calculated MW | 33kDa |
Observed MW | 40-50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse heart |
Cellular location | Cell membrane, Endomembrane system, Single-pass type I membrane protein |
Customer validation | IHC (Human gastric cancer tissue,Human gastric mucosa, Human liver cancerHomo sapiens, Mus musculus, Homo sapiens) WB (Homo sapiens, Mus musculus, Rattus norvegicus) IF (Homo sapiens, Mus musculus) Drug antibody (Homo sapiens) WB FC (Homo sapiens) PD-1/PD-L1 inhibitor resistance experiments (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1645 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CD274. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CD274. (Distance between topics and target gene indicate popularity.) CD274
* Data provided by citexs.com, for reference only.
Publishing research using A1645? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.