Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PCNA Rabbit pAb (A0264)

Publications (92) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PCNA Rabbit pAb (A0264)

Western blot analysis of extracts of various cell lines, using PCNA antibody (A0264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - PCNA Rabbit pAb (A0264)

Western blot analysis of extracts of various cell lines, using PCNA antibody (A0264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PCNA Rabbit pAb (A0264)

Immunohistochemistry analysis of paraffin-embedded mouse colon using PCNA Rabbit pAb (A0264) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PCNA Rabbit pAb (A0264)

Immunohistochemistry analysis of paraffin-embedded mouse testis using PCNA Rabbit pAb (A0264) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PCNA Rabbit pAb (A0264)

Immunohistochemistry analysis of paraffin-embedded rat testis using PCNA Rabbit pAb (A0264) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name PCNA Rabbit pAb
Catalog No. A0264
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1).
Sequence CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Gene ID 5111
Swiss prot P12004
Synonyms ATLD2; PCNA
Calculated MW 29kDa
Observed MW 34kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, MCF7, 293T, COS-7, Rat testis, C2C12
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus, Capra hircus, Bos taurus, Gallus gallus)

IF (Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus, Cervus nippon, Rattus norvegicus)

WB qRT-PCR (Homo sapiens)

Histological staining (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PCNA Rabbit pAb images

ABclonal:Western blot - PCNA Rabbit pAb (A0264)}

Western blot - PCNA Rabbit pAb (A0264)

Western blot analysis of extracts of various cell lines, using PCNA antibody (A0264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - PCNA Rabbit pAb (A0264)}

Western blot - PCNA Rabbit pAb (A0264)

Western blot analysis of extracts of various cell lines, using PCNA antibody (A0264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - PCNA Rabbit pAb (A0264)}

Immunohistochemistry - PCNA Rabbit pAb (A0264)

Immunohistochemistry analysis of paraffin-embedded mouse colon using PCNA Rabbit pAb (A0264) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PCNA Rabbit pAb (A0264)}

Immunohistochemistry - PCNA Rabbit pAb (A0264)

Immunohistochemistry analysis of paraffin-embedded mouse testis using PCNA Rabbit pAb (A0264) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PCNA Rabbit pAb (A0264)}

Immunohistochemistry - PCNA Rabbit pAb (A0264)

Immunohistochemistry analysis of paraffin-embedded rat testis using PCNA Rabbit pAb (A0264) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A0264 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PCNA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PCNA. (Distance between topics and target gene indicate popularity.) PCNA

* Data provided by citexs.com, for reference only.

Publishing research using A0264? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order