Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PCDHA10 Rabbit pAb (A17185)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - PCDHA10 Rabbit pAb (A17185)

Western blot analysis of lysates from U-87MG cells, using PCDHA10 Rabbit pAb (A17185) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name PCDHA10 Rabbit pAb
Catalog No. A17185
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human PCDHA10 (NP_114066.1).
Sequence PRFSVTEQKLSIPESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPVLVLRKLLDREENPQLKLL
Gene ID 56139
Swiss prot Q9Y5I2
Synonyms CNR8; CNRN8; CNRS8; CRNR8; PCDH-ALPHA10; PCDHA10
Calculated MW 103kDa
Observed MW 100kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG
Cellular location extracellular region, plasma membrane

Research Area

PCDHA10 Rabbit pAb images

ABclonal:Western blot - PCDHA10 Rabbit pAb (A17185)}

Western blot - PCDHA10 Rabbit pAb (A17185)

Western blot analysis of lysates from U-87MG cells, using PCDHA10 Rabbit pAb (A17185) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A17185 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PCDHA10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PCDHA10. (Distance between topics and target gene indicate popularity.) PCDHA10

* Data provided by citexs.com, for reference only.

Publishing research using A17185? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order