Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Publications (14) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Western blot analysis of various lysates, using PBEF/Visfatin/NAMPT Rabbit pAb (A0256) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Western blot analysis of various lysates, using PBEF/Visfatin/NAMPT Rabbit pAb (A0256) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Immunohistochemistry analysis of PBEF/Visfatin/NAMPT in paraffin-embedded mouse liver using PBEF/Visfatin/NAMPT Rabbit pAb (A0256) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Immunofluorescence analysis of HeLa cells using PBEF/Visfatin/NAMPT Rabbit pAb (A0256).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

You may also interested in:

Overview

Product name PBEF/Visfatin/NAMPT Rabbit pAb
Catalog No. A0256
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 181-382 of human PBEF/Visfatin/NAMPT (NP_005737.1).
Sequence GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS
Gene ID 10135
Swiss prot P43490
Synonyms VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik; PBEF/Visfatin/NAMPT
Calculated MW 56kDa
Observed MW 56kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HT-1080, NIH/3T3, PC-12
Cellular location Cytoplasm, Nucleus, Secreted
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus)

IF (Rattus norvegicus, Homo sapiens)

IHC (Sus scrofa, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PBEF/Visfatin/NAMPT Rabbit pAb images

ABclonal:Western blot - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)}

Western blot - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Western blot analysis of various lysates, using PBEF/Visfatin/NAMPT Rabbit pAb (A0256) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)}

Western blot - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Western blot analysis of various lysates, using PBEF/Visfatin/NAMPT Rabbit pAb (A0256) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)}

Immunohistochemistry - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Immunohistochemistry analysis of PBEF/Visfatin/NAMPT in paraffin-embedded mouse liver using PBEF/Visfatin/NAMPT Rabbit pAb (A0256) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)}

Immunofluorescence - PBEF/Visfatin/NAMPT Rabbit pAb (A0256)

Immunofluorescence analysis of HeLa cells using PBEF/Visfatin/NAMPT Rabbit pAb (A0256).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Inquire About This Product

Submit your question about A0256 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NAMPT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NAMPT. (Distance between topics and target gene indicate popularity.) NAMPT

* Data provided by citexs.com, for reference only.

Publishing research using A0256? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order