Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PAI-1/Serpin E1 Rabbit mAb (A19096)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - PAI-1/Serpin E1 Rabbit mAb (A19096)

Western blot analysis of extracts of HepG2 cells, using PAI-1/Serpin E1 antibody (A19096) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name PAI-1/Serpin E1 Rabbit mAb
Catalog No. A19096
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0473

Background

This gene encodes a member of the serine proteinase inhibitor (serpin) superfamily. This member is the principal inhibitor of tissue plasminogen activator (tPA) and urokinase (uPA), and hence is an inhibitor of fibrinolysis. The protein also functions as a component of innate antiviral immunity. Defects in this gene are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency), and high concentrations of the gene product are associated with thrombophilia.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121).
Sequence SKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFS
Gene ID 5054
Swiss prot P05121
Synonyms PAI; PAI1; PAI-1; PLANH1; PAI-1/Serpin E1
Calculated MW 45kDa
Observed MW 45kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2
Cellular location Secreted
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PAI-1/Serpin E1 Rabbit mAb images

ABclonal:Western blot - PAI-1/Serpin E1 Rabbit mAb (A19096)}

Western blot - PAI-1/Serpin E1 Rabbit mAb (A19096)

Western blot analysis of extracts of HepG2 cells, using PAI-1/Serpin E1 antibody (A19096) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A19096 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SERPINE1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SERPINE1. (Distance between topics and target gene indicate popularity.) SERPINE1

* Data provided by citexs.com, for reference only.

Publishing research using A19096? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order