Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

p70 S6 Kinase 1 Rabbit pAb (A2190)

Reviews (5) Publications (26) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - p70 S6 Kinase 1 Rabbit pAb (A2190)

Western blot analysis of various lysates using p70 S6 Kinase 1 Rabbit pAb (A2190) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunohistochemistry analysis of p70 S6 Kinase 1 in paraffin-embedded human breast cancer using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunofluorescence analysis of C6 cells using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunofluorescence analysis of NIH-3T3 cells using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunofluorescence analysis of U-2 OS cells using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for p70 S6 Kinase 1 Rabbit pAb(A2190)
Review
ABclonal: review for p70 S6 Kinase 1 Rabbit pAb(A2190)
Review
ABclonal: review for p70 S6 Kinase 1 Rabbit pAb(A2190)
Review
ABclonal: review for p70 S6 Kinase 1 Rabbit pAb(A2190)
Review
ABclonal: review for p70 S6 Kinase 1 Rabbit pAb(A2190)

You may also interested in:

Overview

Product name p70 S6 Kinase 1 Rabbit pAb
Catalog No. A2190
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 421-520 of human p70 S6 Kinase 1 (NP_003152.1).
Sequence SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEH
Gene ID 6198
Swiss prot P23443
Synonyms S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha; p70 S6 Kinase 1
Calculated MW 59kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat, 293T
Cellular location Cell junction, Cytoplasm, Mitochondrion outer membrane, Mitochondrion, Nucleus, synapse, synaptosome
Customer validation

IF (Human bone marrow cancer cell, HeLa cells)

WB (Human chronic myeloid leukemia cells, HeLa, HEK293THomo sapiens, Macaca mulatta, Mus musculus, Homo sapiens, Rattus norvegicus, Spodoptera frugiperda, Gallus gallus, Sus scrofa, Bos taurus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

p70 S6 Kinase 1 Rabbit pAb images

ABclonal:Western blot - p70 S6 Kinase 1 Rabbit pAb (A2190)}

Western blot - p70 S6 Kinase 1 Rabbit pAb (A2190)

Western blot analysis of various lysates using p70 S6 Kinase 1 Rabbit pAb (A2190) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - p70 S6 Kinase 1 Rabbit pAb (A2190)}

Immunohistochemistry - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunohistochemistry analysis of p70 S6 Kinase 1 in paraffin-embedded human breast cancer using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)}

Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunofluorescence analysis of C6 cells using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)}

Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunofluorescence analysis of NIH-3T3 cells using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)}

Immunofluorescence - p70 S6 Kinase 1 Rabbit pAb (A2190)

Immunofluorescence analysis of U-2 OS cells using p70 S6 Kinase 1 1 Rabbit pAb (A2190) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2190

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2190 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RPS6KB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RPS6KB1. (Distance between topics and target gene indicate popularity.) RPS6KB1

* Data provided by citexs.com, for reference only.

Publishing research using A2190? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order