Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Occludin Rabbit pAb (A2601)

Reviews (2) Publications (95) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Occludin Rabbit pAb (A2601)

Western blot analysis of Mouse lung, using Occludin Rabbit pAb (A2601) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Review
ABclonal: review for Occludin Rabbit pAb(A2601)
Review
ABclonal: review for Occludin Rabbit pAb(A2601)

You may also interested in:

Overview

Product name Occludin Rabbit pAb
Catalog No. A2601
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-522 of human Occludin (NP_002529.1).
Sequence TDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Gene ID 100506658
Swiss prot Q16625
Synonyms BLCPMG; PTORCH1; PPP1R115; Occludin
Calculated MW 59kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse lung
Cellular location Cell junction, Membrane, Multi-pass membrane protein, tight junction
Customer validation

(Mouse embryonal fibroblast cell)

WB (Pig cellsSus scrofa, Sus scrofa, Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus, Anatinae, Canis lupus familiaris, Horabagrus nigricollaris)

IF (Mus musculus, Rattus norvegicus, Gallus gallus, Cyprinus carpio, Sus scrofa, Homo sapiens)

IHC (grass carp, Oreochromis niloticus, Mus musculus, Rattus norvegicus, Horabagrus nigricollaris)

ICH (Rattus norvegicus)

ELISA (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Occludin Rabbit pAb images

ABclonal:Western blot - Occludin Rabbit pAb (A2601)}

Western blot - Occludin Rabbit pAb (A2601)

Western blot analysis of Mouse lung, using Occludin Rabbit pAb (A2601) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Submit an review for A2601

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2601 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on OCLN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to OCLN. (Distance between topics and target gene indicate popularity.) OCLN

* Data provided by citexs.com, for reference only.

Publishing research using A2601? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order