Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ODF1 Rabbit pAb (A16023)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ODF1 Rabbit pAb (A16023)

Western blot analysis of various lysates using ODF1 Rabbit pAb (A16023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name ODF1 Rabbit pAb
Catalog No. A16023
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. The human outer dense fibers contains at least 10 major proteins and this gene encodes the main protein.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2).
Sequence LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
Gene ID 4956
Swiss prot Q14990
Synonyms ODF; RT7; ODF2; ODFP; SODF; CT133; ODF27; ODFPG; HSPB10; ODFPGA; ODFPGB; ODF1
Calculated MW 28kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse testis, Rat testis
Cellular location nucleus

ODF1 Rabbit pAb images

ABclonal:Western blot - ODF1 Rabbit pAb (A16023)}

Western blot - ODF1 Rabbit pAb (A16023)

Western blot analysis of various lysates using ODF1 Rabbit pAb (A16023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A16023 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ODF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ODF1. (Distance between topics and target gene indicate popularity.) ODF1

* Data provided by citexs.com, for reference only.

Publishing research using A16023? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order