Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NeuN Rabbit pAb (A17261)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - NeuN Rabbit pAb (A17261)

Western blot analysis of various lysates using NeuN Rabbit pAb (A17261) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - NeuN Rabbit pAb (A17261)

Immunohistochemistry analysis of NeuN in paraffin-embedded Mouse brain using NeuN Rabbit pAb (A17261) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NeuN Rabbit pAb (A17261)

Immunohistochemistry analysis of NeuN in paraffin-embedded Rat brain using NeuN Rabbit pAb (A17261) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name NeuN Rabbit pAb
Catalog No. A17261
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NeuN (NP_001076044.1).
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
Gene ID 146713
Swiss prot A6NFN3
Synonyms FOX3; NEUN; FOX-3; HRNBP3; NeuN
Calculated MW 34kDa
Observed MW 46-55kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NeuN Rabbit pAb images

ABclonal:Western blot - NeuN Rabbit pAb (A17261)}

Western blot - NeuN Rabbit pAb (A17261)

Western blot analysis of various lysates using NeuN Rabbit pAb (A17261) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - NeuN Rabbit pAb (A17261)}

Immunohistochemistry - NeuN Rabbit pAb (A17261)

Immunohistochemistry analysis of NeuN in paraffin-embedded Mouse brain using NeuN Rabbit pAb (A17261) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NeuN Rabbit pAb (A17261)}

Immunohistochemistry - NeuN Rabbit pAb (A17261)

Immunohistochemistry analysis of NeuN in paraffin-embedded Rat brain using NeuN Rabbit pAb (A17261) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A17261 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RBFOX3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RBFOX3. (Distance between topics and target gene indicate popularity.) RBFOX3

* Data provided by citexs.com, for reference only.

Publishing research using A17261? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order