Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NRBF2 Rabbit pAb (A13422)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NRBF2 Rabbit pAb (A13422)

Western blot analysis of extracts of various cell lines, using NRBF2 antibody (A13422) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name NRBF2 Rabbit pAb
Catalog No. A13422
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Involved in autophagy. Located in cytoplasm. Colocalizes with phosphatidylinositol 3-kinase complex, class III.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-220 of human NRBF2 (NP_110386.2).
Sequence LAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDAD
Gene ID 29982
Swiss prot Q96F24
Synonyms COPR; COPR1; COPR2; NRBF-2; NRBF2
Calculated MW 32kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T
Cellular location Cytoplasm, Cytoplasmic vesicle, Nucleus, autophagosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NRBF2 Rabbit pAb images

ABclonal:Western blot - NRBF2 Rabbit pAb (A13422)}

Western blot - NRBF2 Rabbit pAb (A13422)

Western blot analysis of extracts of various cell lines, using NRBF2 antibody (A13422) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A13422 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NRBF2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NRBF2. (Distance between topics and target gene indicate popularity.) NRBF2

* Data provided by citexs.com, for reference only.

Publishing research using A13422? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order