Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NPPA Rabbit pAb (A14755)

Publications (9) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - NPPA Rabbit pAb (A14755)

Western blot analysis of extracts of Mouse heart, using NPPA antibody (A14755) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - NPPA Rabbit pAb (A14755)

Immunohistochemistry analysis of paraffin-embedded mouse heart using NPPA Rabbit pAb (A14755) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NPPA Rabbit pAb (A14755)

Immunohistochemistry analysis of paraffin-embedded rat heart using NPPA Rabbit pAb (A14755) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name NPPA Rabbit pAb
Catalog No. A14755
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human NPPA (NP_006154.1).
Sequence LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN
Gene ID 4878
Swiss prot P01160
Synonyms ANF; ANP; CDD; CDP; PND; ATFB6; ATRST2; CDD-ANF; NPPA
Calculated MW 16kDa
Observed MW 16kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse heart
Cellular location Secreted
Customer validation

WB (Rattus norvegicus, Mus musculus)

PCR (Mus musculus)

IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NPPA Rabbit pAb images

ABclonal:Western blot - NPPA Rabbit pAb (A14755)}

Western blot - NPPA Rabbit pAb (A14755)

Western blot analysis of extracts of Mouse heart, using NPPA antibody (A14755) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - NPPA Rabbit pAb (A14755)}

Immunohistochemistry - NPPA Rabbit pAb (A14755)

Immunohistochemistry analysis of paraffin-embedded mouse heart using NPPA Rabbit pAb (A14755) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NPPA Rabbit pAb (A14755)}

Immunohistochemistry - NPPA Rabbit pAb (A14755)

Immunohistochemistry analysis of paraffin-embedded rat heart using NPPA Rabbit pAb (A14755) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A14755 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NPPA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NPPA. (Distance between topics and target gene indicate popularity.) NPPA

* Data provided by citexs.com, for reference only.

Publishing research using A14755? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order