Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NOX3 Rabbit pAb (A3677)

Publications (4) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NOX3 Rabbit pAb (A3677)

Western blot analysis of various lysates using NOX3 Rabbit pAb (A3677) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name NOX3 Rabbit pAb
Catalog No. A3677
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 223-395 of human NOX3 (NP_056533.1).
Sequence GRIVRGQTQDSLSLHNITFCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVSHPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWTAALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTD
Gene ID 50508
Swiss prot Q9HBY0
Synonyms MOX-2; GP91-3; NOX3
Calculated MW 65kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, HepG2, Mouse brain, Mouse pancreas, Mouse kidney, Rat liver
Cellular location Membrane, Multi-pass membrane protein
Customer validation

WB (Mus musculus, Homo sapiens)

IHC (Mus musculus)

NOX3 Rabbit pAb images

ABclonal:Western blot - NOX3 Rabbit pAb (A3677)}

Western blot - NOX3 Rabbit pAb (A3677)

Western blot analysis of various lysates using NOX3 Rabbit pAb (A3677) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A3677 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NOX3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NOX3. (Distance between topics and target gene indicate popularity.) NOX3

* Data provided by citexs.com, for reference only.

Publishing research using A3677? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order