Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NOTCH3 Rabbit pAb (A3115)

Reviews (2) Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NOTCH3 Rabbit pAb (A3115)

Western blot analysis of lysates from 293T cells, using NOTCH3 Rabbit pAb (A3115) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of NIH/3T3 cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of PC-12 cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of U2OS cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for NOTCH3 Rabbit pAb(A3115)
Review
ABclonal: review for NOTCH3 Rabbit pAb(A3115)

You may also interested in:

Overview

Product name NOTCH3 Rabbit pAb
Catalog No. A3115
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1640 of human NOTCH3 (NP_000426.2).
Sequence PPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPS
Gene ID 4854
Swiss prot Q9UM47
Synonyms IMF2; LMNS; CASIL; CADASIL; CADASIL1; NOTCH3
Calculated MW 244kDa
Observed MW 90kDa/280kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T
Cellular location Cell membrane, Nucleus, Single-pass type I membrane protein
Customer validation

IF (SW480Homo sapiens, Mus musculus)

WB (HEK293T,DLD-1Rattus norvegicus)

IHC (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NOTCH3 Rabbit pAb images

ABclonal:Western blot - NOTCH3 Rabbit pAb (A3115)}

Western blot - NOTCH3 Rabbit pAb (A3115)

Western blot analysis of lysates from 293T cells, using NOTCH3 Rabbit pAb (A3115) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)}

Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of NIH/3T3 cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)}

Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of PC-12 cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)}

Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of U2OS cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A3115

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A3115 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NOTCH3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NOTCH3. (Distance between topics and target gene indicate popularity.) NOTCH3

* Data provided by citexs.com, for reference only.

Publishing research using A3115? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order