Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NOTCH2 Rabbit pAb (A0560)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - NOTCH2 Rabbit pAb (A0560)

Western blot analysis of extracts of various cell lines, using NOTCH2 antibody (A0560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - NOTCH2 Rabbit pAb (A0560)

Immunofluorescence analysis of L929 cells using NOTCH2 antibody (A0560) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name NOTCH2 Rabbit pAb
Catalog No. A0560
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2242-2471 of human NOTCH2 (NP_077719.2).
Sequence SRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHNNMQVYA
Gene ID 4853
Swiss prot Q04721
Synonyms hN2; AGS2; HJCYS; NOTCH2
Calculated MW 265kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, LO2, HeLa
Cellular location Cell membrane, Cytoplasm, Nucleus, Single-pass type I membrane protein
Customer validation

IHC (Mus musculus)

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NOTCH2 Rabbit pAb images

ABclonal:Western blot - NOTCH2 Rabbit pAb (A0560)}

Western blot - NOTCH2 Rabbit pAb (A0560)

Western blot analysis of extracts of various cell lines, using NOTCH2 antibody (A0560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunofluorescence - NOTCH2 Rabbit pAb (A0560)}

Immunofluorescence - NOTCH2 Rabbit pAb (A0560)

Immunofluorescence analysis of L929 cells using NOTCH2 antibody (A0560) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0560 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NOTCH2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NOTCH2. (Distance between topics and target gene indicate popularity.) NOTCH2

* Data provided by citexs.com, for reference only.

Publishing research using A0560? Please let us know so that we can cite the reference in this datasheet.

Proteins (1)

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order