Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NME1/NM23A Rabbit mAb (A8802)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NME1/NM23A Rabbit mAb (A8802)

Western blot analysis of extracts of various cell lines, using NME1/NME1/NM23A Rabbit mAb (A8802) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name NME1/NM23A Rabbit mAb
Catalog No. A8802
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1309

Background

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NME1/NME1/NM23A (P15531).
Sequence MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK
Gene ID 4830
Swiss prot P15531
Synonyms NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1; NME1/NM23A
Calculated MW 17kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, C6, Rat lung, Rat brain
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NME1/NM23A Rabbit mAb images

ABclonal:Western blot - NME1/NM23A Rabbit mAb (A8802)}

Western blot - NME1/NM23A Rabbit mAb (A8802)

Western blot analysis of extracts of various cell lines, using NME1/NME1/NM23A Rabbit mAb (A8802) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A8802 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NME1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NME1. (Distance between topics and target gene indicate popularity.) NME1

* Data provided by citexs.com, for reference only.

Publishing research using A8802? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order