Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NLRP6 Rabbit pAb (A15628)

Publications (11) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NLRP6 Rabbit pAb (A15628)

Western blot analysis of various lysates, using NLRP6 antibody (A15628) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name NLRP6 Rabbit pAb
Catalog No. A15628
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene binds arginine-vasopressin and may be involved in the arginine-vasopressin-mediated regulation of renal salt-water balance. The encoded protein also mediates inflammatory responses in the colon to allow recovery from intestinal epithelial damage and protects against tumorigenesis and the development of colitis. Finally, this protein can increase activation of NF-kappa-B, activation of CASP1 through interaction with ASC, and cAMP accumulation. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-110 of human NLRP6 (NP_612202.2).
Sequence MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSG
Gene ID 171389
Swiss prot P59044
Synonyms AVR; NAVR; PAN3; NALP6; PYPAF5; CLR11.4; NAVR/AVR; NLRP6
Calculated MW 99kDa
Observed MW 102kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse large intestine, Rat thymus
Cellular location cytoplasm, cytosol, inflammasome complex, NLRP6 inflammasome complex, nuclear membrane, plasma membrane
Customer validation

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

IF (Mus musculus, Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NLRP6 Rabbit pAb images

ABclonal:Western blot - NLRP6 Rabbit pAb (A15628)}

Western blot - NLRP6 Rabbit pAb (A15628)

Western blot analysis of various lysates, using NLRP6 antibody (A15628) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A15628 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NLRP6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NLRP6. (Distance between topics and target gene indicate popularity.) NLRP6

* Data provided by citexs.com, for reference only.

Publishing research using A15628? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order