Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NLGN2 Rabbit pAb (A14418)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

You may also interested in:

Overview

Product name NLGN2 Rabbit pAb
Catalog No. A14418
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 15-180 of human NLGN2 (NP_065846.1).
Sequence QRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM
Gene ID 57555
Swiss prot Q8NFZ4
Synonyms NLGN2
Calculated MW 91kDa
Observed MW Refer to Figures

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location Cell junction, Cell membrane, Single-pass type I membrane protein, postsynaptic cell membrane, presynaptic cell membrane, synapse

Research Area

Inquire About This Product

Submit your question about A14418 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NLGN2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NLGN2. (Distance between topics and target gene indicate popularity.) NLGN2

* Data provided by citexs.com, for reference only.

Publishing research using A14418? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order