Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Mouse, Rat
Product name | NKX2-5 Rabbit pAb |
---|---|
Catalog No. | A12688 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human NKX2-5 (NP_004378.1). |
---|---|
Sequence | AFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQV |
Gene ID | 1482 |
Swiss prot | P52952 |
Synonyms | CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1; NKX2-5 |
Calculated MW | 35kDa |
Observed MW | 48kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse heart, Rat heart |
Cellular location | Nucleus |
Customer validation | WB (Mus musculus) ELISA (Homo sapiens) |
Submit your question about A12688 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on NKX2-5. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to NKX2-5. (Distance between topics and target gene indicate popularity.) NKX2-5
* Data provided by citexs.com, for reference only.
Publishing research using A12688? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.