Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NIN Rabbit pAb (A8215)

Review (1) Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NIN Rabbit pAb (A8215)

Western blot analysis of extracts of Jurkat cells, using NIN antibody (A8215) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunohistochemistry - NIN Rabbit pAb (A8215)

Immunohistochemistry analysis of paraffin-embedded human stomach using NIN antibody (A8215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NIN Rabbit pAb (A8215)

Immunohistochemistry analysis of paraffin-embedded rat kidney using NIN antibody (A8215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NIN Rabbit pAb (A8215)

Immunohistochemistry analysis of paraffin-embedded mouse lung using NIN antibody (A8215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review
ABclonal: review for NIN Rabbit pAb(A8215)

You may also interested in:

Overview

Product name NIN Rabbit pAb
Catalog No. A8215
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of the proteins important for centrosomal function. This protein is important for positioning and anchoring the microtubules minus-ends in epithelial cells. Localization of this protein to the centrosome requires three leucine zippers in the central coiled-coil domain. Multiple alternatively spliced transcript variants that encode different isoforms have been reported.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human NIN (NP_891991.1).
Sequence MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEFPEVTVIEPLDEEARPSHIPAGDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQDWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVEDFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMT
Gene ID 51199
Swiss prot Q8N4C6
Synonyms SCKL7; NIN
Calculated MW 243kDa
Observed MW 190kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat
Cellular location Cytoplasm, centrosome, cytoskeleton, microtubule organizing center
Customer validation

IF (HumanHomo sapiens, Homo sapiens)

WB (Homo sapiens, Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NIN Rabbit pAb images

ABclonal:Western blot - NIN Rabbit pAb (A8215)}

Western blot - NIN Rabbit pAb (A8215)

Western blot analysis of extracts of Jurkat cells, using NIN antibody (A8215) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.
ABclonal:Immunohistochemistry - NIN Rabbit pAb (A8215)}

Immunohistochemistry - NIN Rabbit pAb (A8215)

Immunohistochemistry analysis of paraffin-embedded human stomach using NIN antibody (A8215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NIN Rabbit pAb (A8215)}

Immunohistochemistry - NIN Rabbit pAb (A8215)

Immunohistochemistry analysis of paraffin-embedded rat kidney using NIN antibody (A8215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NIN Rabbit pAb (A8215)}

Immunohistochemistry - NIN Rabbit pAb (A8215)

Immunohistochemistry analysis of paraffin-embedded mouse lung using NIN antibody (A8215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Submit an review for A8215

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A8215 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NIN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NIN. (Distance between topics and target gene indicate popularity.) NIN

* Data provided by citexs.com, for reference only.

Publishing research using A8215? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order