Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NF-kB p65/RelA Rabbit pAb (A2547)

Reviews (6) Publications (135) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A2547)

Western blot analysis of various lysates using NF-kB p65/RelA Rabbit pAb (A2547) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A2547)

Western blot analysis of various lysates, using NF-kB p65/RelA Rabbit pAb (A2547) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A2547)

Western blot analysis of lysates from wild type(WT) and NF-kB p65/RelA knockout (KO) HeLa(KO) cells, using NF-kB p65/RelA Rabbit pAb (A2547) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human colon using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded mouse kidney using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded rat testis using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human colon using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded mouse colon using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded rat heart using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of HepG2 cells using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of HepG2 cells using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A2547)
Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A2547)
Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A2547)
Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A2547)
Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A2547)
Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A2547)

You may also interested in:

Overview

Product name NF-kB p65/RelA Rabbit pAb
Catalog No. A2547
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-550 of human NF-kB p65/RelA (NP_068810.3).
Sequence LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS
Gene ID 5970
Swiss prot Q04206
Synonyms p65; CMCU; NFKB3; AIF3BL3; NF-kB p65/RelA
Calculated MW 60kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, MCF7, Mouse lung, Mouse kidney, Rat lung, Rat kidney
Cellular location Cytoplasm, Nucleus
Customer validation

WB (RAW264.7, Mouse atherosclerosis arterial tissue, HCC827, U251Homo sapiens, Homo sapiens, Macaca mulatta, Rattus norvegicus, Gallus gallus, Mus musculus, Sus scrofa, Schisandra chinensis, Alpinia katsumadai Hayata, Bos taurus, King Charles Spaniel, Cryptosporidium parvum)

IF (Rat H9c2 cellsMus musculus, Rattus norvegicus, Homo sapiens, Mus musculus)

ChIP (Homo sapiens)

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

IB (Homo sapiens)

PE (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NF-kB p65/RelA Rabbit pAb images

ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A2547)}

Western blot - NF-kB p65/RelA Rabbit pAb (A2547)

Western blot analysis of various lysates using NF-kB p65/RelA Rabbit pAb (A2547) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A2547)}

Western blot - NF-kB p65/RelA Rabbit pAb (A2547)

Western blot analysis of various lysates, using NF-kB p65/RelA Rabbit pAb (A2547) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A2547)}

Western blot - NF-kB p65/RelA Rabbit pAb (A2547)

Western blot analysis of lysates from wild type(WT) and NF-kB p65/RelA knockout (KO) HeLa(KO) cells, using NF-kB p65/RelA Rabbit pAb (A2547) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human colon using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded mouse kidney using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded rat testis using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded human colon using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded mouse colon using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunohistochemistry - NF-kB p65/RelA Rabbit pAb (A2547)

Immunohistochemistry analysis of NF-kB p65/RelA in paraffin-embedded rat heart using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of HepG2 cells using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of HepG2 cells using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)}

Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A2547)

Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit pAb (A2547) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2547

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2547 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RELA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RELA. (Distance between topics and target gene indicate popularity.) RELA

* Data provided by citexs.com, for reference only.

Publishing research using A2547? Please let us know so that we can cite the reference in this datasheet.

Antibodies (23)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order