Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NFE2L1 Rabbit pAb (A14753)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NFE2L1 Rabbit pAb (A14753)

Western blot analysis of various lysates using NFE2L1 Rabbit pAb (A14753) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)

Immunohistochemistry analysis of NFE2L1 in paraffin-embedded rat heart using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)

Immunohistochemistry analysis of NFE2L1 in paraffin-embedded human placenta using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)

Immunohistochemistry analysis of NFE2L1 in paraffin-embedded mouse brain using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - NFE2L1 Rabbit pAb (A14753)

Immunofluorescence analysis of HeLa cells using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name NFE2L1 Rabbit pAb
Catalog No. A14753
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for "nuclear respiratory factor 1" which has an official symbol of NRF1.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 515-772 of human NFE2L1 (NP_003195.1).
Sequence SSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRRK
Gene ID 4779
Swiss prot Q14494
Synonyms NRF1; NRF-1; TCF11; LCR-F1; NFE2L1
Calculated MW 85kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, HepG2, Jurkat
Cellular location Endoplasmic reticulum membrane, Nucleus, Single-pass type II membrane protein
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NFE2L1 Rabbit pAb images

ABclonal:Western blot - NFE2L1 Rabbit pAb (A14753)}

Western blot - NFE2L1 Rabbit pAb (A14753)

Western blot analysis of various lysates using NFE2L1 Rabbit pAb (A14753) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)}

Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)

Immunohistochemistry analysis of NFE2L1 in paraffin-embedded rat heart using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)}

Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)

Immunohistochemistry analysis of NFE2L1 in paraffin-embedded human placenta using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)}

Immunohistochemistry - NFE2L1 Rabbit pAb (A14753)

Immunohistochemistry analysis of NFE2L1 in paraffin-embedded mouse brain using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - NFE2L1 Rabbit pAb (A14753)}

Immunofluorescence - NFE2L1 Rabbit pAb (A14753)

Immunofluorescence analysis of HeLa cells using NFE2L1 Rabbit pAb (A14753) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14753 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NFE2L1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NFE2L1. (Distance between topics and target gene indicate popularity.) NFE2L1

* Data provided by citexs.com, for reference only.

Publishing research using A14753? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order