Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NDUFS7 Rabbit pAb (A7862)

Publication (1) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NDUFS7 Rabbit pAb (A7862)

Western blot analysis of extracts of mouse skeletal muscle, using NDUFS7 antibody (A7862) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name NDUFS7 Rabbit pAb
Catalog No. A7862
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 39-213 of human NDUFS7 (NP_077718.3).
Sequence PSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
Gene ID 374291
Swiss prot O75251
Synonyms PSST; CI-20; MY017; MC1DN3; CI-20KD; NDUFS7
Calculated MW 24kDa
Observed MW 24kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse skeletal muscle
Cellular location Mitochondrion
Customer validation

WB (Mus musculus)

IF (Mus musculus)

Research Area

NDUFS7 Rabbit pAb images

ABclonal:Western blot - NDUFS7 Rabbit pAb (A7862)}

Western blot - NDUFS7 Rabbit pAb (A7862)

Western blot analysis of extracts of mouse skeletal muscle, using NDUFS7 antibody (A7862) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A7862 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NDUFS7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NDUFS7. (Distance between topics and target gene indicate popularity.) NDUFS7

* Data provided by citexs.com, for reference only.

Publishing research using A7862? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order