Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NDUFS1 Rabbit pAb (A2592)

Review (1) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NDUFS1 Rabbit pAb (A2592)

Western blot analysis of extracts of various cell lines, using NDUFS1 antibody (A2592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)

Immunohistochemistry analysis of paraffin-embedded human colon using NDUFS1 Rabbit pAb (A2592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)

Immunohistochemistry analysis of paraffin-embedded mouse testis using NDUFS1 Rabbit pAb (A2592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)

Immunohistochemistry analysis of paraffin-embedded rat testis using NDUFS1 Rabbit pAb (A2592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Review
ABclonal: review for NDUFS1 Rabbit pAb(A2592)

You may also interested in:

Overview

Product name NDUFS1 Rabbit pAb
Catalog No. A2592
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-290 of human NDUFS1 (NP_004997.4).
Sequence VEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKT
Gene ID 4719
Swiss prot P28331
Synonyms CI-75k; MC1DN5; CI-75Kd; PRO1304; NDUFS1
Calculated MW 79kDa
Observed MW 79kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, Raji, NCI-H460, PC-3, 293T, HepG2, Mouse kidney, Mouse heart, Mouse intestine
Cellular location Mitochondrion inner membrane
Customer validation

WB (Mouse heartRattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NDUFS1 Rabbit pAb images

ABclonal:Western blot - NDUFS1 Rabbit pAb (A2592)}

Western blot - NDUFS1 Rabbit pAb (A2592)

Western blot analysis of extracts of various cell lines, using NDUFS1 antibody (A2592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)}

Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)

Immunohistochemistry analysis of paraffin-embedded human colon using NDUFS1 Rabbit pAb (A2592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)}

Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)

Immunohistochemistry analysis of paraffin-embedded mouse testis using NDUFS1 Rabbit pAb (A2592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)}

Immunohistochemistry - NDUFS1 Rabbit pAb (A2592)

Immunohistochemistry analysis of paraffin-embedded rat testis using NDUFS1 Rabbit pAb (A2592) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Submit an review for A2592

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2592 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NDUFS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NDUFS1. (Distance between topics and target gene indicate popularity.) NDUFS1

* Data provided by citexs.com, for reference only.

Publishing research using A2592? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order