Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)

Review (1) Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)

Western blot analysis of various lysates, using [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Western blot - [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)

Western blot analysis of lysates from wild type(WT) and NDUFA13/GRIM19 Rabbit pAb knockdown (KD) 293T cells, using [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Review
ABclonal: review for [KD Validated] NDUFA13/GRIM19 Rabbit pAb(A5412)

You may also interested in:

Overview

Product name [KD Validated] NDUFA13/GRIM19 Rabbit pAb
Catalog No. A5412
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human NDUFA13/GRIM19 (NP_057049.5).
Sequence MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Gene ID 51079
Swiss prot Q9P0J0
Synonyms B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28; [KD Validated] NDUFA13/GRIM19
Calculated MW 17kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, HepG2, PC-3
Cellular location Matrix side, Mitochondrion inner membrane, Nucleus, Single-pass membrane protein
Customer validation

WB (C2C12Homo sapiens, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] NDUFA13/GRIM19 Rabbit pAb images

ABclonal:Western blot - [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)}

Western blot - [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)

Western blot analysis of various lysates, using [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Western blot - [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)}

Western blot - [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412)

Western blot analysis of lysates from wild type(WT) and NDUFA13/GRIM19 Rabbit pAb knockdown (KD) 293T cells, using [KD Validated] NDUFA13/GRIM19 Rabbit pAb (A5412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Submit an review for A5412

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5412 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NDUFA13. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NDUFA13. (Distance between topics and target gene indicate popularity.) NDUFA13

* Data provided by citexs.com, for reference only.

Publishing research using A5412? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order