Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NDUFA11 Rabbit pAb (A16239)

Publications (5) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - NDUFA11 Rabbit pAb (A16239)

Western blot analysis of various lysates using NDUFA11 Rabbit pAb (A16239) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name NDUFA11 Rabbit pAb
Catalog No. A16239
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a subunit of the membrane-bound mitochondrial complex I. Complex I is composed of numerous subunits and functions as the NADH-ubiquinol reductase of the mitochondrial electron transport chain. Mutations in this gene are associated with severe mitochondrial complex I deficiency. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFA11 (NP_783313.1).
Sequence MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLT
Gene ID 126328
Swiss prot Q86Y39
Synonyms B14.7; MC1DN14; CI-B14.7; NDUFA11
Calculated MW 15kDa
Observed MW 15kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples mouse heart, mouse kidney, mouse liver
Cellular location mitochondrial inner membrane, mitochondrial respiratory chain complex I, mitochondrion
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

IF (Rattus norvegicus)

Research Area

NDUFA11 Rabbit pAb images

ABclonal:Western blot - NDUFA11 Rabbit pAb (A16239)}

Western blot - NDUFA11 Rabbit pAb (A16239)

Western blot analysis of various lysates using NDUFA11 Rabbit pAb (A16239) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A16239 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NDUFA11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NDUFA11. (Distance between topics and target gene indicate popularity.) NDUFA11

* Data provided by citexs.com, for reference only.

Publishing research using A16239? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order