Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Myelin Basic Protein Rabbit pAb (A1664)

Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Myelin Basic Protein Rabbit pAb (A1664)

Western blot analysis of extracts of various cell lines, using Myelin Basic Protein antibody (A1664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)

Immunohistochemistry analysis of paraffin-embedded human brain using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)

Immunohistochemistry analysis of paraffin-embedded mouse brain using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)

Immunohistochemistry analysis of paraffin-embedded rat brain using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Myelin Basic Protein Rabbit pAb (A1664)

Immunofluorescence analysis of mouse brain cells using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Myelin Basic Protein Rabbit pAb (A1664)

Immunofluorescence analysis of rat brain cells using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Myelin Basic Protein Rabbit pAb
Catalog No. A1664
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-165 of human Myelin Basic Protein (NP_001020272.1).
Sequence AHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPR
Gene ID 4155
Swiss prot P02686
Synonyms MBP; Myelin Basic Protein
Calculated MW 33kDa
Observed MW 12-18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasmic side, Myelin membrane, Nucleus, Peripheral membrane protein
Customer validation

WB (Rattus norvegicus, Arabidopsis thaliana)

IHC (Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Myelin Basic Protein Rabbit pAb images

ABclonal:Western blot - Myelin Basic Protein Rabbit pAb (A1664)}

Western blot - Myelin Basic Protein Rabbit pAb (A1664)

Western blot analysis of extracts of various cell lines, using Myelin Basic Protein antibody (A1664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)}

Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)

Immunohistochemistry analysis of paraffin-embedded human brain using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)}

Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)

Immunohistochemistry analysis of paraffin-embedded mouse brain using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)}

Immunohistochemistry - Myelin Basic Protein Rabbit pAb (A1664)

Immunohistochemistry analysis of paraffin-embedded rat brain using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Myelin Basic Protein Rabbit pAb (A1664)}

Immunofluorescence - Myelin Basic Protein Rabbit pAb (A1664)

Immunofluorescence analysis of mouse brain cells using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Myelin Basic Protein Rabbit pAb (A1664)}

Immunofluorescence - Myelin Basic Protein Rabbit pAb (A1664)

Immunofluorescence analysis of rat brain cells using Myelin Basic Protein Rabbit pAb (A1664) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1664 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MBP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MBP. (Distance between topics and target gene indicate popularity.) MBP

* Data provided by citexs.com, for reference only.

Publishing research using A1664? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order