Product Type > Antibodies > Tag and Loading Control Antibodies

Mouse anti GFP-Tag mAb (AE012)

Publications (184) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Species independent

ABclonal:Western blot - Mouse anti GFP-Tag mAb (AE012)

Western blot analysis of insect expressed GFP protein using Mouse anti GFP-Tag mAb (AE012) at different dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - Mouse anti GFP-Tag mAb (AE012)

Immunofluorescence analysis of GFP transgenic HeLa cells using Mouse anti GFP-Tag mAb (AE012). Green: GFP expression. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Mouse anti GFP-Tag mAb
Catalog No. AE012
Host species Mouse
Purification method Affinity purification
Isotype IgG
CloneNo. AMC0483R

Background

The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to light in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorea victoria. The GFP from A. victoria has a major excitation peak at a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in the lower green portion of the visible spectrum. The GFP from the sea pansy (Renilla reniformis) has a single major excitation peak at 498 nm. GFP makes for an excellent tool in many forms of biology due to its ability to form internal chromophore without requiring any accessory cofactors, gene products, or enzymes / substrates other than molecular oxygen.In cell and molecular biology, the GFP gene is frequently used as a reporter of expression. It has been used in modified forms to make biosensors, and many animals have been created that express GFP, which demonstrates a proof of concept that a gene can be expressed throughout a given organism, in selected organs, or in cells of interest. GFP can be introduced into animals or other species through transgenic techniques, and maintained in their genome and that of their offspring. To date, GFP has been expressed in many species, including bacteria, yeasts, fungi, fish and mammals, including in human cells.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 to the N-terminus of GFP protein.
Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF
Gene ID
Swiss prot
Synonyms GFP; GFP tag; GFP-tag
Calculated MW 27kDa
Observed MW 27kDa

Applications

Reactivity Species independent
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:5000
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples insect expression of GFP
Cellular location
Customer validation

IF (Homo sapiens, Mus musculus, Drosophila melanogaster, Arabidopsis thaliana, Nicotiana tabacum, Rattus norvegicus, Chlorocebus aethiops)

WB (Homo sapiens, Saccharomyces cerevisiae, Arabidopsis thaliana, Nicotiana tabacum L, Rosa rugosa Thunb, Mus musculus, Yeast, Nicotiana tabacum L., Chlorocebus sabaeus, Other, N. benthamiana, Helicoverpa armigera, Cotton bollworms, Populus, Solanum tuberosum, Oryza sativa, Ictalurus punctatus, Anatinae, Ctenopharyngodon idellus, N. benthamiana plants, Pyrus pyrifolia, Hordeum vulgare, Juvenile tilapia, G.hirsutum, Phytophthora capsici, N. tabacum, Nicotiana benthamiana, Danio rerio, N. tabacum, Nicotiana tabacum, Carassius auratus gibelio, Caenorhabditis elegans, Solanum lycopersicum L, Cynoglossus robustus, Zea mays, tobacco, M. oryzae, Triticum aestivum, Chlorocebus aethiops, Tadarida brasiliensis, , Sus scrofa, Rattus norvegicus, Stemphylium eturmiunum, Actinopterygii, Glycine max)

Co-IP (Mus musculus, Cucumis sativus, Oryza sativa, Homo sapiens, Helicoverpa armigera, Pinus massoniana, Glycine max L, Oryza sativa L., Apple, Arabidopsis thaliana, Stemphylium eturmiunum, B. napus, Other)

IP (Mus musculus, Triticum aestivum, Nicotiana tabacum, N. benthamiana, Zea mays, Homo sapiens, Ctenopharyngodon idellus, Anatinae, Arabidopsis thaliana, Ictalurus punctatus, Chlorocebus aethiops)

IHC (Mus musculus, Homo sapiens, Rattus norvegicus)

MS (Mus musculus)

IB (Ctenopharyngodon idellus, Oryza sativa)

co-IP (Ctenopharyngodon idellus, Arabidopsis thaliana)

CHIP (Gossypium spp)

ChIP (Arabidopsis thaliana, Other)

WB IF IP (Homo sapiens)

CO-IP (Hippophae rhamnoides subsp)

FRET (Homo sapiens)

pull-down (Arabidopsis)

RIP (Arabidopsis thaliana)

CUT&Tag (Oryza sativa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Mouse anti GFP-Tag mAb images

ABclonal:Western blot - Mouse anti GFP-Tag mAb (AE012)}

Western blot - Mouse anti GFP-Tag mAb (AE012)

Western blot analysis of insect expressed GFP protein using Mouse anti GFP-Tag mAb (AE012) at different dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - Mouse anti GFP-Tag mAb (AE012)}

Immunofluorescence - Mouse anti GFP-Tag mAb (AE012)

Immunofluorescence analysis of GFP transgenic HeLa cells using Mouse anti GFP-Tag mAb (AE012). Green: GFP expression. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about AE012 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GFP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GFP. (Distance between topics and target gene indicate popularity.) GFP

* Data provided by citexs.com, for reference only.

Publishing research using AE012? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order