Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MAP2 Rabbit pAb (A17409)

Publications (8) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MAP2 Rabbit pAb (A17409)

Western blot analysis of various lysates, using MAP2 antibody (A17409) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Rat brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Rat brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MAP2 Rabbit pAb (A17409)

Immunofluorescence analysis of mouse brain cells using MAP2 Rabbit pAb (A17409) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MAP2 Rabbit pAb (A17409)

Immunofluorescence analysis of rat brain cells using MAP2 Rabbit pAb (A17409) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MAP2 Rabbit pAb
Catalog No. A17409
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1510-1650 of human MAP2 (NP_002365.3).
Sequence GGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTP
Gene ID 4133
Swiss prot P11137
Synonyms MAP-2; MAP2A; MAP2B; MAP2C; MAP2
Calculated MW 200kDa
Observed MW 75kDa/280kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SH-SY5Y, PC-12
Cellular location Cytoplasm, cytoskeleton
Customer validation

IF (Rattus norvegicus, Mus musculus)

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MAP2 Rabbit pAb images

ABclonal:Western blot - MAP2 Rabbit pAb (A17409)}

Western blot - MAP2 Rabbit pAb (A17409)

Western blot analysis of various lysates, using MAP2 antibody (A17409) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)}

Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Rat brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)}

Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Rat brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)}

Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MAP2 Rabbit pAb (A17409)}

Immunohistochemistry - MAP2 Rabbit pAb (A17409)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using MAP2 antibody (A17409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - MAP2 Rabbit pAb (A17409)}

Immunofluorescence - MAP2 Rabbit pAb (A17409)

Immunofluorescence analysis of mouse brain cells using MAP2 Rabbit pAb (A17409) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MAP2 Rabbit pAb (A17409)}

Immunofluorescence - MAP2 Rabbit pAb (A17409)

Immunofluorescence analysis of rat brain cells using MAP2 Rabbit pAb (A17409) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A17409 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAP2. (Distance between topics and target gene indicate popularity.) MAP2

* Data provided by citexs.com, for reference only.

Publishing research using A17409? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order