Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MYL9 Rabbit pAb (A3039)

Reviews (2) Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MYL9 Rabbit pAb (A3039)

Western blot analysis of extracts of various cell lines, using MYL9 antibody (A3039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Rat intestine using MYL9 antibody (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Human colon carcinoma using MYL9 antibody (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Mouse intestine using MYL9 antibody (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

Review
ABclonal: review for MYL9 Rabbit pAb(A3039)
Review
ABclonal: review for MYL9 Rabbit pAb(A3039)

You may also interested in:

Overview

Product name MYL9 Rabbit pAb
Catalog No. A3039
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2).
Sequence MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE
Gene ID 10398
Swiss prot P24844
Synonyms LC20; MLC2; MRLC1; MYRL2; MLC-2C; MMIHS4; MYL9
Calculated MW 20kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples C2C12, C6, Mouse lung, Rat heart
Cellular location cell cortex, cytoplasm, cytosol, myofibril, Z disc
Customer validation

WB (HepG2)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MYL9 Rabbit pAb images

ABclonal:Western blot - MYL9 Rabbit pAb (A3039)}

Western blot - MYL9 Rabbit pAb (A3039)

Western blot analysis of extracts of various cell lines, using MYL9 antibody (A3039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)}

Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Rat intestine using MYL9 antibody (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)}

Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Human colon carcinoma using MYL9 antibody (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)}

Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Mouse intestine using MYL9 antibody (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

Submit an review for A3039

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A3039 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYL9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYL9. (Distance between topics and target gene indicate popularity.) MYL9

* Data provided by citexs.com, for reference only.

Publishing research using A3039? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order