Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MYH9 Rabbit pAb (A16923)

Review (1) Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MYH9 Rabbit pAb (A16923)

Western blot analysis of extracts of various cell lines, using MYH9 antibody (A16923) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - MYH9 Rabbit pAb (A16923)

Immunohistochemistry analysis of paraffin-embedded rat kidney using MYH9 Rabbit pAb (A16923) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MYH9 Rabbit pAb (A16923)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using MYH9 Rabbit pAb (A16923) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MYH9 Rabbit pAb (A16923)

Immunohistochemistry analysis of paraffin-embedded human placenta using MYH9 Rabbit pAb (A16923) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for MYH9 Rabbit pAb(A16923)

You may also interested in:

Overview

Product name MYH9 Rabbit pAb
Catalog No. A16923
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1801-1960 of human MYH9 (NP_002464.1).
Sequence VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Gene ID 4627
Swiss prot P35579
Synonyms MHA; FTNS; EPSTS; BDPLT6; DFNA17; MATINS; NMMHCA; NMHC-II-A; NMMHC-IIA; MYH9
Calculated MW 227kDa
Observed MW 250kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, HT-29, A-549, NIH/3T3, C6
Cellular location Cytoplasm, cell cortex, cytoskeleton
Customer validation

(HL-60、HepG2 、MCF-7、T-47D、MLOT-4)

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MYH9 Rabbit pAb images

ABclonal:Western blot - MYH9 Rabbit pAb (A16923)}

Western blot - MYH9 Rabbit pAb (A16923)

Western blot analysis of extracts of various cell lines, using MYH9 antibody (A16923) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - MYH9 Rabbit pAb (A16923)}

Immunohistochemistry - MYH9 Rabbit pAb (A16923)

Immunohistochemistry analysis of paraffin-embedded rat kidney using MYH9 Rabbit pAb (A16923) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MYH9 Rabbit pAb (A16923)}

Immunohistochemistry - MYH9 Rabbit pAb (A16923)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using MYH9 Rabbit pAb (A16923) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MYH9 Rabbit pAb (A16923)}

Immunohistochemistry - MYH9 Rabbit pAb (A16923)

Immunohistochemistry analysis of paraffin-embedded human placenta using MYH9 Rabbit pAb (A16923) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A16923

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A16923 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYH9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYH9. (Distance between topics and target gene indicate popularity.) MYH9

* Data provided by citexs.com, for reference only.

Publishing research using A16923? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order