Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

c-Myc Rabbit pAb (A1309)

Reviews (2) Publications (43) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - c-Myc Rabbit pAb (A1309)

Western blot analysis of lysates from HeLa cells, using c-Myc Rabbit pAb (A1309) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Review
ABclonal: review for c-Myc Rabbit pAb(A1309)
Review
ABclonal: review for c-Myc Rabbit pAb(A1309)

You may also interested in:

Overview

Product name c-Myc Rabbit pAb
Catalog No. A1309
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 347-439 of human c-Myc (NP_001341799.1).
Sequence LRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRRE
Gene ID 4609
Swiss prot P01106
Synonyms MRTL; MYCC; c-Myc; bHLHe39
Calculated MW 51kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Nucleus, nucleolus, nucleoplasm
Customer validation

WB (unknow, Human Bladder CancerHomo sapiens, Homo sapiens, Gallus gallus, Mus musculus, Sus scrofa, Homo sapiensMus musculus)

Co-IP (Homo sapiens, Gallus gallus, Mus musculus)

ChIP (Homo sapiens, Mus musculus)

IF (Danio rerio)

qRT-PCR (Danio rerio)

IHC (Homo sapiens)

IP (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

c-Myc Rabbit pAb images

ABclonal:Western blot - c-Myc Rabbit pAb (A1309)}

Western blot - c-Myc Rabbit pAb (A1309)

Western blot analysis of lysates from HeLa cells, using c-Myc Rabbit pAb (A1309) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Submit an review for A1309

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1309 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYC. (Distance between topics and target gene indicate popularity.) MYC

* Data provided by citexs.com, for reference only.

Publishing research using A1309? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order