Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

mTOR Rabbit pAb (A11354)

Review (1) Publications (17) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - mTOR Rabbit pAb (A11354)

Western blot analysis of lysates from K562 cells, using mTOR Rabbit pAb (A11354) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - mTOR Rabbit pAb (A11354)

Immunohistochemistry analysis of mTOR in paraffin-embedded rat ovary using mTOR Rabbit pAb (A11354) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - mTOR Rabbit pAb (A11354)

Immunohistochemistry analysis of mTOR in paraffin-embedded human placenta using mTOR Rabbit pAb (A11354) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - mTOR Rabbit pAb (A11354)

Immunohistochemistry analysis of mTOR in paraffin-embedded mouse kidney using mTOR Rabbit pAb (A11354) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11354)

Immunofluorescence analysis of C6 cells using mTOR Rabbit pAb (A11354) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11354)

Immunofluorescence analysis of NIH-3T3 cells using mTOR Rabbit pAb (A11354) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for mTOR Rabbit pAb(A11354)

You may also interested in:

Overview

Product name mTOR Rabbit pAb
Catalog No. A11354
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mTORC1, which controls protein synthesis, cell growth and proliferation, and mTORC2, which is a regulator of the actin cytoskeleton, and promotes cell survival and cell cycle progression. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. Inhibitors of mTOR are used in organ transplants as immunosuppressants, and are being evaluated for their therapeutic potential in SARS-CoV-2 infections. Mutations in this gene are associated with Smith-Kingsmore syndrome and somatic focal cortical dysplasia type II. The ANGPTL7 gene is located in an intron of this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2388-2487 of human mTOR (NP_004949.1).
Sequence EVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGL
Gene ID 2475
Swiss prot P42345
Synonyms SKS; FRAP; FRAP1; FRAP2; RAFT1; RAPT1; mTOR
Calculated MW 289kDa
Observed MW 288kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples K-562
Cellular location Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Golgi apparatus membrane, Lysosome, Mitochondrion outer membrane, Nucleus, PML body, Peripheral membrane protein
Customer validation

WB (MSC cellsHomo sapiens, Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Mus musculus)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

mTOR Rabbit pAb images

ABclonal:Western blot - mTOR Rabbit pAb (A11354)}

Western blot - mTOR Rabbit pAb (A11354)

Western blot analysis of lysates from K562 cells, using mTOR Rabbit pAb (A11354) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - mTOR Rabbit pAb (A11354)}

Immunohistochemistry - mTOR Rabbit pAb (A11354)

Immunohistochemistry analysis of mTOR in paraffin-embedded rat ovary using mTOR Rabbit pAb (A11354) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - mTOR Rabbit pAb (A11354)}

Immunohistochemistry - mTOR Rabbit pAb (A11354)

Immunohistochemistry analysis of mTOR in paraffin-embedded human placenta using mTOR Rabbit pAb (A11354) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - mTOR Rabbit pAb (A11354)}

Immunohistochemistry - mTOR Rabbit pAb (A11354)

Immunohistochemistry analysis of mTOR in paraffin-embedded mouse kidney using mTOR Rabbit pAb (A11354) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11354)}

Immunofluorescence - mTOR Rabbit pAb (A11354)

Immunofluorescence analysis of C6 cells using mTOR Rabbit pAb (A11354) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - mTOR Rabbit pAb (A11354)}

Immunofluorescence - mTOR Rabbit pAb (A11354)

Immunofluorescence analysis of NIH-3T3 cells using mTOR Rabbit pAb (A11354) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A11354

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11354 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MTOR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MTOR. (Distance between topics and target gene indicate popularity.) MTOR

* Data provided by citexs.com, for reference only.

Publishing research using A11354? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order