Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MTAP Rabbit pAb (A1049)

Review (1) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MTAP Rabbit pAb (A1049)

Western blot analysis of lysates from NIH/3T3 cells, using MTAP Rabbit pAb (A1049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - MTAP Rabbit pAb (A1049)

Western blot analysis of various lysates using MTAP Rabbit pAb (A1049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - MTAP Rabbit pAb (A1049)

Immunohistochemistry analysis of MTAP in paraffin-embedded human colon carcinoma using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MTAP Rabbit pAb (A1049)

Immunohistochemistry analysis of MTAP in paraffin-embedded mouse kidney using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MTAP Rabbit pAb (A1049)

Immunohistochemistry analysis of MTAP in paraffin-embedded rat ovary using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MTAP Rabbit pAb (A1049)

Immunofluorescence analysis of HeLa cells using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MTAP Rabbit pAb (A1049)

Immunofluorescence analysis of NIH/3T3 cells using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MTAP Rabbit pAb (A1049)

Immunofluorescence analysis of PC-12 cells using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for MTAP Rabbit pAb(A1049)

You may also interested in:

Overview

Product name MTAP Rabbit pAb
Catalog No. A1049
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage pathway of both adenine and methionine. The encoded enzyme is deficient in many cancers. Multiple alternatively spliced transcript variants have been described for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-283 of human MTAP (NP_002442.2).
Sequence MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Gene ID 4507
Swiss prot Q13126
Synonyms BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249; MTAP
Calculated MW 31kDa
Observed MW 29kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, HT-29, A-549, NIH/3T3
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Human cellsHomo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MTAP Rabbit pAb images

ABclonal:Western blot - MTAP Rabbit pAb (A1049)}

Western blot - MTAP Rabbit pAb (A1049)

Western blot analysis of lysates from NIH/3T3 cells, using MTAP Rabbit pAb (A1049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - MTAP Rabbit pAb (A1049)}

Western blot - MTAP Rabbit pAb (A1049)

Western blot analysis of various lysates using MTAP Rabbit pAb (A1049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - MTAP Rabbit pAb (A1049)}

Immunohistochemistry - MTAP Rabbit pAb (A1049)

Immunohistochemistry analysis of MTAP in paraffin-embedded human colon carcinoma using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MTAP Rabbit pAb (A1049)}

Immunohistochemistry - MTAP Rabbit pAb (A1049)

Immunohistochemistry analysis of MTAP in paraffin-embedded mouse kidney using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MTAP Rabbit pAb (A1049)}

Immunohistochemistry - MTAP Rabbit pAb (A1049)

Immunohistochemistry analysis of MTAP in paraffin-embedded rat ovary using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - MTAP Rabbit pAb (A1049)}

Immunofluorescence - MTAP Rabbit pAb (A1049)

Immunofluorescence analysis of HeLa cells using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MTAP Rabbit pAb (A1049)}

Immunofluorescence - MTAP Rabbit pAb (A1049)

Immunofluorescence analysis of NIH/3T3 cells using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MTAP Rabbit pAb (A1049)}

Immunofluorescence - MTAP Rabbit pAb (A1049)

Immunofluorescence analysis of PC-12 cells using MTAP Rabbit pAb (A1049) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1049

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1049 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MTAP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MTAP. (Distance between topics and target gene indicate popularity.) MTAP

* Data provided by citexs.com, for reference only.

Publishing research using A1049? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order