Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MMP14/MT1-MMP Rabbit pAb (A2549)

Review (1) Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MMP14/MT1-MMP Rabbit pAb (A2549)

Western blot analysis of lysates from Rat spleen using MMP14/MT1-MMP Rabbit pAb(A2549) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunohistochemistry analysis of MMP14/MT1-MMP in paraffin-embedded human colon carcinoma using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunohistochemistry analysis of MMP14/MT1-MMP in paraffin-embedded mouse kidney using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunohistochemistry analysis of MMP14/MT1-MMP in paraffin-embedded rat kidney using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunofluorescence analysis of HeLa cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunofluorescence analysis of NIH/3T3 cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunofluorescence analysis of PC-12 cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for MMP14/MT1-MMP Rabbit pAb(A2549)

You may also interested in:

Overview

Product name MMP14/MT1-MMP Rabbit pAb
Catalog No. A2549
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 75-174 of human MMP14/MMP14/MT1-MMP (NP_004986.1).
Sequence QVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQ
Gene ID 4323
Swiss prot P50281
Synonyms MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1; MMP14/MT1-MMP
Calculated MW 66kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Rat spleen
Cellular location Cytoplasm, Melanosome, Membrane, Single-pass type I membrane protein
Customer validation

WB (MDA-MB-231Mus musculus, Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP14/MT1-MMP Rabbit pAb images

ABclonal:Western blot - MMP14/MT1-MMP Rabbit pAb (A2549)}

Western blot - MMP14/MT1-MMP Rabbit pAb (A2549)

Western blot analysis of lysates from Rat spleen using MMP14/MT1-MMP Rabbit pAb(A2549) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)}

Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunohistochemistry analysis of MMP14/MT1-MMP in paraffin-embedded human colon carcinoma using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)}

Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunohistochemistry analysis of MMP14/MT1-MMP in paraffin-embedded mouse kidney using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)}

Immunohistochemistry - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunohistochemistry analysis of MMP14/MT1-MMP in paraffin-embedded rat kidney using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)}

Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunofluorescence analysis of HeLa cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)}

Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunofluorescence analysis of NIH/3T3 cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)}

Immunofluorescence - MMP14/MT1-MMP Rabbit pAb (A2549)

Immunofluorescence analysis of PC-12 cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2549

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2549 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP14. (Distance between topics and target gene indicate popularity.) MMP14

* Data provided by citexs.com, for reference only.

Publishing research using A2549? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order