Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MRPL22 Rabbit pAb (A14586)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - MRPL22 Rabbit pAb (A14586)

Western blot analysis of various lysates using MRPL22 Rabbit pAb (A14586) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name MRPL22 Rabbit pAb
Catalog No. A14586
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L22 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 4q. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 97-206 of human MRPL22 (NP_054899.2).
Sequence LAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Gene ID 29093
Swiss prot Q9NWU5
Synonyms L22mt; RPML25; HSPC158; MRP-L22; MRP-L25; MRPL22
Calculated MW 24kDa
Observed MW 24kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain, Mouse heart, Mouse kidney, Rat lung
Cellular location Mitochondrion

Research Area

MRPL22 Rabbit pAb images

ABclonal:Western blot - MRPL22 Rabbit pAb (A14586)}

Western blot - MRPL22 Rabbit pAb (A14586)

Western blot analysis of various lysates using MRPL22 Rabbit pAb (A14586) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A14586 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MRPL22. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MRPL22. (Distance between topics and target gene indicate popularity.) MRPL22

* Data provided by citexs.com, for reference only.

Publishing research using A14586? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order