Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MMP9 Rabbit pAb (A2095)

Review (1) Publications (24) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - MMP9 Rabbit pAb (A2095)

Western blot analysis of lysates from Mouse spleen using MMP9 Rabbit pAb(A2095) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:30s.

Review
ABclonal: review for MMP9 Rabbit pAb(A2095)

You may also interested in:

Overview

Product name MMP9 Rabbit pAb
Catalog No. A2095
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 538-707 of human MMP9 (NP_004985.2).
Sequence KYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Gene ID 4318
Swiss prot P14780
Synonyms GELB; CLG4B; MMP-9; MANDP2; MMP9
Calculated MW 78kDa
Observed MW 100kDa/84kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples K-562, Mouse brain, Mouse spleen, Mouse spleen
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

WB (Human cellsHomo sapiens, Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus)

IF (Mus musculus, Homo sapiens)

Homo sapiens (IP, WB, IF)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP9 Rabbit pAb images

ABclonal:Western blot - MMP9 Rabbit pAb (A2095)}

Western blot - MMP9 Rabbit pAb (A2095)

Western blot analysis of lysates from Mouse spleen using MMP9 Rabbit pAb(A2095) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:30s.

Submit an review for A2095

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2095 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP9. (Distance between topics and target gene indicate popularity.) MMP9

* Data provided by citexs.com, for reference only.

Publishing research using A2095? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (2)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order