Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MIP Rabbit pAb (A2886)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MIP Rabbit pAb (A2886)

Western blot analysis of extracts of various cell lines, using MIP antibody (A2886) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - MIP Rabbit pAb (A2886)

Immunohistochemistry analysis of paraffin-embedded mouse brain using MIP antibody (A2886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MIP Rabbit pAb (A2886)

Immunohistochemistry analysis of paraffin-embedded human stomach using MIP antibody (A2886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MIP Rabbit pAb (A2886)

Immunohistochemistry analysis of paraffin-embedded rat brain using MIP antibody (A2886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name MIP Rabbit pAb
Catalog No. A2886
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Major intrinsic protein is a member of the water-transporting aquaporins as well as the original member of the MIP family of channel proteins. The function of the fiber cell membrane protein encoded by this gene is undetermined, yet this protein is speculated to play a role in intracellular communication. The MIP protein is expressed in the ocular lens and is required for correct lens function. This gene has been mapped among aquaporins AQP2, AQP5, and AQP6, in a potential gene cluster at 12q13.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MIP (NP_036196.1).
Sequence LALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYD
Gene ID 4284
Swiss prot P30301
Synonyms AQP0; LIM1; MP26; MIP26; CTRCT15; MIP
Calculated MW 28kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:100 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HepG2, U-251MG, Mouse skeletal muscle, Mouse heart, Mouse liver, Mouse testis, Mouse eye, Rat eye
Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, gap junction

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MIP Rabbit pAb images

ABclonal:Western blot - MIP Rabbit pAb (A2886)}

Western blot - MIP Rabbit pAb (A2886)

Western blot analysis of extracts of various cell lines, using MIP antibody (A2886) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - MIP Rabbit pAb (A2886)}

Immunohistochemistry - MIP Rabbit pAb (A2886)

Immunohistochemistry analysis of paraffin-embedded mouse brain using MIP antibody (A2886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MIP Rabbit pAb (A2886)}

Immunohistochemistry - MIP Rabbit pAb (A2886)

Immunohistochemistry analysis of paraffin-embedded human stomach using MIP antibody (A2886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MIP Rabbit pAb (A2886)}

Immunohistochemistry - MIP Rabbit pAb (A2886)

Immunohistochemistry analysis of paraffin-embedded rat brain using MIP antibody (A2886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2886 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MIP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MIP. (Distance between topics and target gene indicate popularity.) MIP

* Data provided by citexs.com, for reference only.

Publishing research using A2886? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order