Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MGMT Rabbit pAb (A0693)

Reviews (3) Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - MGMT Rabbit pAb (A0693)

Western blot analysis of extracts of various cell lines, using MGMT antibody (A0693) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Review
ABclonal: review for MGMT Rabbit pAb(A0693)
Review
ABclonal: review for MGMT Rabbit pAb(A0693)
Review
ABclonal: review for MGMT Rabbit pAb(A0693)

You may also interested in:

Overview

Product name MGMT Rabbit pAb
Catalog No. A0693
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human MGMT (NP_002403.2).
Sequence MLGQPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Gene ID 4255
Swiss prot P16455
Synonyms MGMT
Calculated MW 22kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, Mouse liver, Mouse spleen
Cellular location Nucleus
Customer validation

IHC (Human glioma tissue)

WB (HepG2Homo sapiens, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MGMT Rabbit pAb images

ABclonal:Western blot - MGMT Rabbit pAb (A0693)}

Western blot - MGMT Rabbit pAb (A0693)

Western blot analysis of extracts of various cell lines, using MGMT antibody (A0693) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Submit an review for A0693

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0693 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MGMT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MGMT. (Distance between topics and target gene indicate popularity.) MGMT

* Data provided by citexs.com, for reference only.

Publishing research using A0693? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order