Reviews (2) Publications (34) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | METTL14 Rabbit pAb |
---|---|
Catalog No. | A8530 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1). |
---|---|
Sequence | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC |
Gene ID | 57721 |
Swiss prot | Q9HCE5 |
Synonyms | hMETTL14; METTL14 |
Calculated MW | 52kDa |
Observed MW | 65kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | Mouse testis, Rat testis |
Cellular location | Nucleus |
Customer validation | WB (Human breast cancerMus musculus, Rattus norvegicus, Homo sapiens, Mus musculus, Gallus gallus, Sus scrofa, Homo sapiensMus musculus) IF (Human breast cancerMus musculus, Homo sapiens, Rattus norvegicus, Mus musculus) Co-IP (Homo sapiens, Mus musculus) IHC (Mus musculus, Rattus norvegicus, Homo sapiens) ICC (Mus musculus) RIP (Homo sapiens) RT-PCR (Homo sapiens) IP (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A8530 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on METTL14. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to METTL14. (Distance between topics and target gene indicate popularity.) METTL14
* Data provided by citexs.com, for reference only.
Publishing research using A8530? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.