Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

METTL14 Rabbit pAb (A8530)

Reviews (2) Publications (34) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - METTL14 Rabbit pAb (A8530)

Western blot analysis of various lysates, using METTL14 Rabbit pAb (A8530) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded human colon using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded mouse testis using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded human colon using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded mouse testis using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for METTL14 Rabbit pAb(A8530)
Review
ABclonal: review for METTL14 Rabbit pAb(A8530)

You may also interested in:

Overview

Product name METTL14 Rabbit pAb
Catalog No. A8530
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables mRNA binding activity. Contributes to mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity. Involved in mRNA metabolic process; negative regulation of hematopoietic progenitor cell differentiation; and positive regulation of translation. Located in nucleoplasm. Part of RNA N6-methyladenosine methyltransferase complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1).
Sequence MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC
Gene ID 57721
Swiss prot Q9HCE5
Synonyms hMETTL14; METTL14
Calculated MW 52kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse testis, Rat testis
Cellular location Nucleus
Customer validation

WB (Human breast cancerMus musculus, Rattus norvegicus, Homo sapiens, Mus musculus, Gallus gallus, Sus scrofa, Homo sapiensMus musculus)

IF (Human breast cancerMus musculus, Homo sapiens, Rattus norvegicus, Mus musculus)

Co-IP (Homo sapiens, Mus musculus)

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

ICC (Mus musculus)

RIP (Homo sapiens)

RT-PCR (Homo sapiens)

IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

METTL14 Rabbit pAb images

ABclonal:Western blot - METTL14 Rabbit pAb (A8530)}

Western blot - METTL14 Rabbit pAb (A8530)

Western blot analysis of various lysates, using METTL14 Rabbit pAb (A8530) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)}

Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded human colon using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)}

Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded mouse testis using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)}

Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded human colon using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - METTL14 Rabbit pAb (A8530)}

Immunohistochemistry - METTL14 Rabbit pAb (A8530)

Immunohistochemistry analysis of paraffin-embedded mouse testis using METTL14 Rabbit pAb (A8530) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A8530

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A8530 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on METTL14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to METTL14. (Distance between topics and target gene indicate popularity.) METTL14

* Data provided by citexs.com, for reference only.

Publishing research using A8530? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order