Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MEGF10 Rabbit pAb (A10508)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MEGF10 Rabbit pAb (A10508)

Western blot analysis of U-251 MG, using MEGF10 Rabbit pAb (A10508) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name MEGF10 Rabbit pAb
Catalog No. A10508
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the multiple epidermal growth factor-like domains protein family. The encoded protein plays a role in cell adhesion, motility and proliferation, and is a critical mediator of apoptotic cell phagocytosis as well as amyloid-beta peptide uptake in the brain. Expression of this gene may be associated with schizophrenia, and mutations in this gene are a cause of early-onset myopathy, areflexia, respiratory distress, and dysphagia (EMARDD) as well as congenital myopathy with minicores. Alternatively spliced transcript variants have been observed for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-160 of human MEGF10 (NP_115822.1).
Sequence ADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTVTKSKNNQLFVNLKNVNPGKRGPVGDCTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSNCSLSSSENPYATIKDPPV
Gene ID 84466
Swiss prot Q96KG7
Synonyms SR-F3; EMARDD; CMYP10A; CMYP10B; MEGF10
Calculated MW 122kDa
Observed MW 130kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-251 MG
Cellular location Basolateral cell membrane, Cell membrane, Cell projection, Single-pass type I membrane protein, phagocytic cup
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MEGF10 Rabbit pAb images

ABclonal:Western blot - MEGF10 Rabbit pAb (A10508)}

Western blot - MEGF10 Rabbit pAb (A10508)

Western blot analysis of U-251 MG, using MEGF10 Rabbit pAb (A10508) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10508 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MEGF10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MEGF10. (Distance between topics and target gene indicate popularity.) MEGF10

* Data provided by citexs.com, for reference only.

Publishing research using A10508? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order