Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ERK1 / ERK2 Rabbit pAb (A16686)

Publications (64) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ERK1 / ERK2 Rabbit pAb (A16686)

Western blot analysis of various lysates using ERK1 / ERK2 Rabbit pAb (A16686) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded human breast cancer using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded human lung cancer using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded mouse heart using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded mouse kidney using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded rat brain using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded rat kidney using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ERK1 / ERK2 Rabbit pAb (A16686)

Immunofluorescence analysis of NIH/3T3 cells using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ERK1 / ERK2 Rabbit pAb
Catalog No. A16686
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK1 / ERK2 (NP_620407.1/NP_002737.2).
Sequence LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Gene ID 55945595
Swiss prot P28482P27361
Synonyms MAPK1/MAPK3; ERK1 / ERK2
Calculated MW 36kDa/41kDa/38kDa/40kDa/43kDa
Observed MW 42kDa/44kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, C6, Mouse brain, Rat brain
Cellular location caveola, cytoplasm, cytoskeleton, cytosol, early endosome, endoplasmic reticulum lumen, extracellular region, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, mitotic spindle, nucleoplasm, nucleus, plasma membrane
Customer validation

WB (Homo sapiens, Mus musculus, Cyprinus carpio, Capra hircus, Sus scrofa, Rattus norvegicus, Bos taurus, Gallus gallus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ERK1 / ERK2 Rabbit pAb images

ABclonal:Western blot - ERK1 / ERK2 Rabbit pAb (A16686)}

Western blot - ERK1 / ERK2 Rabbit pAb (A16686)

Western blot analysis of various lysates using ERK1 / ERK2 Rabbit pAb (A16686) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded human breast cancer using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded human lung cancer using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded mouse heart using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded mouse kidney using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded rat brain using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunohistochemistry - ERK1 / ERK2 Rabbit pAb (A16686)

Immunohistochemistry analysis of ERK1 / ERK2 in paraffin-embedded rat kidney using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ERK1 / ERK2 Rabbit pAb (A16686)}

Immunofluorescence - ERK1 / ERK2 Rabbit pAb (A16686)

Immunofluorescence analysis of NIH/3T3 cells using ERK1 / ERK2 Rabbit pAb (A16686) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16686 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAPK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAPK1. (Distance between topics and target gene indicate popularity.) MAPK1

* Data provided by citexs.com, for reference only.

Publishing research using A16686? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order