Reviews (3) Publications (18) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | p38 MAPK Rabbit pAb |
---|---|
Catalog No. | A0227 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 261-360 of human p38 MAPK (NP_620581.1). |
---|---|
Sequence | SLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Gene ID | 1432 |
Swiss prot | Q16539 |
Synonyms | RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA; p38 MAPK |
Calculated MW | 41kDa |
Observed MW | 38kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | PC-12, 293T, Jurkat, NIH/3T3, Mouse liver |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB (Raw264.7, HepG2, MouseMus musculus, Homo sapiens, Mus musculus, Rattus norvegicus, Danio rerio, Gallus gallus) IF (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0227 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MAPK14. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MAPK14. (Distance between topics and target gene indicate popularity.) MAPK14
* Data provided by citexs.com, for reference only.
Publishing research using A0227? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.