Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KD Validated] LC3B Rabbit pAb (A7198)

Reviews (11) Publications (40) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] LC3B Rabbit pAb (A7198)

Western blot analysis of various lysates using [KD Validated] LC3B Rabbit pAb (A7198) at 1:1000 dilution.NIH/3T3 and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KD Validated] LC3B Rabbit pAb (A7198)

Western blot analysis of lysates from wild type (WT) and LC3B knockdown (KD) 293T, 293T+chloroquine cells, using [KD Validated] LC3B Rabbit pAb (A7198) at 1:1000 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)

Immunohistochemistry analysis of LC3B in paraffin-embedded rat brain using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)

Immunohistochemistry analysis of LC3B in paraffin-embedded human breast cancer using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)

Immunohistochemistry analysis of LC3B in paraffin-embedded human stomach using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KD Validated] LC3B Rabbit pAb (A7198)

Immunofluorescence analysis of paraffin-embedded rat brain using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)
Review
ABclonal: review for [KD Validated] LC3B Rabbit pAb(A7198)

You may also interested in:

Overview

Product name [KD Validated] LC3B Rabbit pAb
Catalog No. A7198
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LC3B (NP_073729.1).
Sequence MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
Gene ID 81631
Swiss prot Q9GZQ8
Synonyms LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; 3B
Calculated MW 15kDa
Observed MW 14kDa/16kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, NIH/3T3, C6
Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton
Customer validation

WB (MSC cells, Human lung cancer cell, C2C12, Mouse cells, 293T, Rat cellsMus musculus, Sus scrofa, Bombyx mori, Mus musculus, Homo sapiens, Rattus norvegicus, Danio rerio)

IHC (Squamous cell carcinomaHomo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens)

IF (U87MGMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] LC3B Rabbit pAb images

ABclonal:Western blot - [KD Validated] LC3B Rabbit pAb (A7198)}

Western blot - [KD Validated] LC3B Rabbit pAb (A7198)

Western blot analysis of various lysates using [KD Validated] LC3B Rabbit pAb (A7198) at 1:1000 dilution.NIH/3T3 and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KD Validated] LC3B Rabbit pAb (A7198)}

Western blot - [KD Validated] LC3B Rabbit pAb (A7198)

Western blot analysis of lysates from wild type (WT) and LC3B knockdown (KD) 293T, 293T+chloroquine cells, using [KD Validated] LC3B Rabbit pAb (A7198) at 1:1000 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)}

Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)

Immunohistochemistry analysis of LC3B in paraffin-embedded rat brain using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)}

Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)

Immunohistochemistry analysis of LC3B in paraffin-embedded human breast cancer using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)}

Immunohistochemistry - [KD Validated] LC3B Rabbit pAb (A7198)

Immunohistochemistry analysis of LC3B in paraffin-embedded human stomach using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KD Validated] LC3B Rabbit pAb (A7198)}

Immunofluorescence - [KD Validated] LC3B Rabbit pAb (A7198)

Immunofluorescence analysis of paraffin-embedded rat brain using [KD Validated] LC3B Rabbit pAb (A7198) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A7198

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7198 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAP1LC3B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAP1LC3B. (Distance between topics and target gene indicate popularity.) MAP1LC3B

* Data provided by citexs.com, for reference only.

Publishing research using A7198? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order