Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MAN2A2 Rabbit pAb (A19323)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - MAN2A2 Rabbit pAb (A19323)

Western blot analysis of lysates from U-87MG cells, using MAN2A2 Rabbit pAb (A19323) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name MAN2A2 Rabbit pAb
Catalog No. A19323
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable alpha-mannosidase activity. Predicted to be involved in N-glycan processing and protein deglycosylation. Predicted to be integral component of membrane. Predicted to be active in Golgi membrane.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAN2A2 (NP_006113.2).
Sequence VPPEPRPSFFSISPQDCQFALGGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMV
Gene ID 4122
Swiss prot P49641
Synonyms MANA2X; MAN2A2
Calculated MW 131kDa
Observed MW 128kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG
Cellular location
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

MAN2A2 Rabbit pAb images

ABclonal:Western blot - MAN2A2 Rabbit pAb (A19323)}

Western blot - MAN2A2 Rabbit pAb (A19323)

Western blot analysis of lysates from U-87MG cells, using MAN2A2 Rabbit pAb (A19323) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A19323 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAN2A2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAN2A2. (Distance between topics and target gene indicate popularity.) MAN2A2

* Data provided by citexs.com, for reference only.

Publishing research using A19323? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order