Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MAD2B/MAD2L2 Rabbit pAb (A12559)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MAD2B/MAD2L2 Rabbit pAb (A12559)

Western blot analysis of extracts of various cell lines, using MAD2B/MAD2B/MAD2L2 antibody (A12559) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)

Immunofluorescence analysis of H9C2 cells using MAD2B/MAD2B/MAD2L2 antibody (A12559) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)

Immunofluorescence analysis of L929 cells using MAD2B/MAD2B/MAD2L2 antibody (A12559) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)

Immunofluorescence analysis of U2OS cells using MAD2B/MAD2B/MAD2L2 antibody (A12559) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MAD2B/MAD2L2 Rabbit pAb
Catalog No. A12559
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human MAD2B/MAD2B/MAD2L2 (NP_006332.3).
Sequence MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Gene ID 10459
Swiss prot Q9UI95
Synonyms REV7; FANCV; MAD2B; POLZ2; MAD2B/MAD2L2
Calculated MW 24kDa
Observed MW 24kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples SH-SY5Y, A375, K-562, SW480, HeLa, Mouse liver, Rat liver
Cellular location Cytoplasm, Nucleus, cytoskeleton, spindle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MAD2B/MAD2L2 Rabbit pAb images

ABclonal:Western blot - MAD2B/MAD2L2 Rabbit pAb (A12559)}

Western blot - MAD2B/MAD2L2 Rabbit pAb (A12559)

Western blot analysis of extracts of various cell lines, using MAD2B/MAD2B/MAD2L2 antibody (A12559) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)}

Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)

Immunofluorescence analysis of H9C2 cells using MAD2B/MAD2B/MAD2L2 antibody (A12559) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)}

Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)

Immunofluorescence analysis of L929 cells using MAD2B/MAD2B/MAD2L2 antibody (A12559) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)}

Immunofluorescence - MAD2B/MAD2L2 Rabbit pAb (A12559)

Immunofluorescence analysis of U2OS cells using MAD2B/MAD2B/MAD2L2 antibody (A12559) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12559 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAD2L2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAD2L2. (Distance between topics and target gene indicate popularity.) MAD2L2

* Data provided by citexs.com, for reference only.

Publishing research using A12559? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order