Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MAD2/MAD2L1 Rabbit pAb (A1699)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - MAD2/MAD2L1 Rabbit pAb (A1699)

Western blot analysis of various lysates using MAD2/MAD2L1 Rabbit pAb (A1699) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MAD2/MAD2L1 Rabbit pAb (A1699)

Immunofluorescence analysis of U2OS cells using MAD2/MAD2L1 Rabbit pAb (A1699). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MAD2/MAD2L1 Rabbit pAb
Catalog No. A1699
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human MAD2/MAD2/MAD2L1 (NP_002349.1).
Sequence MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Gene ID 4085
Swiss prot Q13257
Synonyms MAD2; HSMAD2; MAD2/MAD2L1
Calculated MW 24kDa
Observed MW 24kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples MCF7, SW480, K-562, Jurkat, 293T, 22Rv1
Cellular location Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, kinetochore, spindle pole
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MAD2/MAD2L1 Rabbit pAb images

ABclonal:Western blot - MAD2/MAD2L1 Rabbit pAb (A1699)}

Western blot - MAD2/MAD2L1 Rabbit pAb (A1699)

Western blot analysis of various lysates using MAD2/MAD2L1 Rabbit pAb (A1699) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - MAD2/MAD2L1 Rabbit pAb (A1699)}

Immunofluorescence - MAD2/MAD2L1 Rabbit pAb (A1699)

Immunofluorescence analysis of U2OS cells using MAD2/MAD2L1 Rabbit pAb (A1699). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1699 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAD2L1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAD2L1. (Distance between topics and target gene indicate popularity.) MAD2L1

* Data provided by citexs.com, for reference only.

Publishing research using A1699? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order