Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LSM4 Rabbit pAb (A13588)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - LSM4 Rabbit pAb (A13588)

Western blot analysis of various lysates using LSM4 Rabbit pAb (A13588) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.

ABclonal:Immunohistochemistry - LSM4 Rabbit pAb (A13588)

Immunohistochemistry analysis of LSM4 in paraffin-embedded rat testis using LSM4 Rabbit pAb (A13588) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - LSM4 Rabbit pAb (A13588)

Immunohistochemistry analysis of LSM4 in paraffin-embedded human colon using LSM4 Rabbit pAb (A13588) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - LSM4 Rabbit pAb (A13588)

Immunofluorescence analysis of HeLa cells using LSM4 Rabbit pAb (A13588) at dilution of 1:50. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - LSM4 Rabbit pAb (A13588)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells using 1 μg LSM4 antibody (A13588). Western blot was performed from the immunoprecipitate using LSM4 antibody (A13588) at a dilution of 1:1000.

You may also interested in:

Overview

Product name LSM4 Rabbit pAb
Catalog No. A13588
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-139 of human LSM4 (NP_036453.1).
Sequence MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Gene ID 25804
Swiss prot Q9Y4Z0
Synonyms GRP; YER112W; LSM4
Calculated MW 15kDa
Observed MW 14kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HepG2, MCF-7, Jurkat
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LSM4 Rabbit pAb images

ABclonal:Western blot - LSM4 Rabbit pAb (A13588)}

Western blot - LSM4 Rabbit pAb (A13588)

Western blot analysis of various lysates using LSM4 Rabbit pAb (A13588) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.
ABclonal:Immunohistochemistry - LSM4 Rabbit pAb (A13588)}

Immunohistochemistry - LSM4 Rabbit pAb (A13588)

Immunohistochemistry analysis of LSM4 in paraffin-embedded rat testis using LSM4 Rabbit pAb (A13588) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - LSM4 Rabbit pAb (A13588)}

Immunohistochemistry - LSM4 Rabbit pAb (A13588)

Immunohistochemistry analysis of LSM4 in paraffin-embedded human colon using LSM4 Rabbit pAb (A13588) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - LSM4 Rabbit pAb (A13588)}

Immunofluorescence - LSM4 Rabbit pAb (A13588)

Immunofluorescence analysis of HeLa cells using LSM4 Rabbit pAb (A13588) at dilution of 1:50. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - LSM4 Rabbit pAb (A13588)}

Immunoprecipitation - LSM4 Rabbit pAb (A13588)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells using 1 μg LSM4 antibody (A13588). Western blot was performed from the immunoprecipitate using LSM4 antibody (A13588) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A13588 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LSM4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LSM4. (Distance between topics and target gene indicate popularity.) LSM4

* Data provided by citexs.com, for reference only.

Publishing research using A13588? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order